<entry xmlns="http://pdbe.org/empiar" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="https://ftp.ebi.ac.uk/pub/databases/emtest/empiar/schema/empiar.xsd" accessionCode="EMPIAR-13371" schemaVersion="0.65" public="true">
    <admin>
        <currentStatus>REL</currentStatus>
        <keyDates>
            <depositionDate>2026-03-14</depositionDate>
            <releaseDate>2026-03-18</releaseDate>
            <updateDate>2026-03-18</updateDate>
        </keyDates>
        <title>Clostridium butyricum Argonaute catalytic mutant in ternary form (bound to guide DNA and target DNA) and de novo designed Dimbd2</title>
        <correspondingAuthor private="true">
            <authorORCID>0000-0003-1560-5769</authorORCID>
            <firstName>Martin</firstName>
            <lastName>Pacesa</lastName>
            <organization type="academic">University of Zurich</organization>
            <street>Winterthurerstrasse 190</street>
            <townOrCity>Zurich</townOrCity>
            <country>Switzerland</country>
            <postOrZipCode>8051</postOrZipCode>
        </correspondingAuthor>
        <principalInvestigator private="true">
            <authorORCID>0000-0003-1560-5769</authorORCID>
            <firstName>Martin</firstName>
            <lastName>Pacesa</lastName>
            <organization type="academic">University of Zurich</organization>
            <street>Winterthurerstrasse 190</street>
            <townOrCity>Zurich</townOrCity>
            <country>Switzerland</country>
            <postOrZipCode>8051</postOrZipCode>
        </principalInvestigator>
        <principalInvestigator private="true">
            <firstName>Bruno</firstName>
            <lastName>Correia</lastName>
            <organization type="academic">EPFL</organization>
            <townOrCity>Lausanne</townOrCity>
            <country>Switzerland</country>
            <postOrZipCode>1015</postOrZipCode>
        </principalInvestigator>
        <authorsList>
            <author authorORCID="0000-0002-6332-354X">Barendse P</author>
            <author>van Drimmelen M</author>
            <author authorORCID="0000-0003-1560-5769">Pacesa M</author>
            <author>Sivaraman A</author>
            <author>Zhang DK</author>
            <author>Nickel L</author>
            <author>Niault T</author>
            <author>Lindhoud S</author>
            <author>Roosjen M</author>
            <author>Hegge JW</author>
            <author>Park K</author>
            <author>Correia BE</author>
            <author>van der Oost J</author>
            <author>Joo C</author>
            <author>Westphal AH</author>
            <author authorORCID="0000-0003-4412-9191">Swarts DC</author>
        </authorsList>
        <grantSupport>
            <grantReference>
                <fundingBody>Swiss National Science Foundation</fundingBody>
                <code>310030188744</code>
                <country>Switzerland</country>
            </grantReference>
        </grantSupport>
        <datasetSize units="TB">4.0</datasetSize>
        <entryDOI>10.6019/EMPIAR-13371</entryDOI>
        <experimentType>IHM</experimentType>
        <scale>molecule</scale>
    </admin>
    <crossReferences>
        <citationList>
            <universalCitation>
                <journalCitation published="false" preprint="false">
                    <author authorORCID="0000-0002-6332-354X" order="1">Barendse P</author>
                    <author order="2">van Drimmelen M</author>
                    <author authorORCID="0000-0003-1560-5769" order="3">Pacesa M</author>
                    <author order="4">Sivaraman A</author>
                    <author order="5">Zhang DK</author>
                    <author order="6">Nickel L</author>
                    <author order="7">Niault T</author>
                    <author order="8">Lindhoud S</author>
                    <author order="9">Roosjen M</author>
                    <author order="10">Hegge JW</author>
                    <author order="11">Park K</author>
                    <author order="12">Correia BE</author>
                    <author order="13">van der Oost J</author>
                    <author order="14">Joo C</author>
                    <author order="15">Westphal AH</author>
                    <author authorORCID="0000-0003-4412-9191" order="16">Swarts DC</author>
                    <title>Target-DNA binding-induced dimerization is required for catalytic activation of Clostridium butyricum Argonaute</title>
                    <journal></journal>
                    <journalAbbreviation></journalAbbreviation>
                    <country></country>
                    <year>2026</year>
                    <language>English</language>
                    <details>Sample of catalytic double mutant D541A, D611A of Clostridium butyricum Argonaute in ternary form (mix of monomers and dimers), bound to single stranded guide DNA ([P]-ATTTATGTGATTTTTC), single stranded target DNA (GAAAAATCACATAAAT), and BindCraft-designed de novo dimer disrupting binder Dimbd2 (KSFEEKKEIVIGMLRYMLENFEEYVELYPDNEVLQTLVPEFKKLVEELESETDKEKFLEKLKEISEIYAKLLKEIFGDNGRSLEELKEKIFVHFSGALE). Purified in buffer 20 mM Tris-HCl pH 7.5, 250 mM KCl, 5% glycerol.
50 frame movies, with a 50 e/A^2 electron dose, on a 300 kV Titan Krios with Falcon 4i detector, with 2.7 mm C2 lens, collected with a 0.57 A pixel size.</details>
                </journalCitation>
            </universalCitation>
        </citationList>
    </crossReferences>
    <imageSet>
        <name>Movies of CbAgo catalytic mutant in ternary form, complexed with guide DNA, target DNA, and de novo designed dimer disrupting binder Dimbd2</name>
        <directory>/data</directory>
        <category>micrographs - multiframe</category>
        <headerFormat>EER</headerFormat>
        <dataFormat>EER</dataFormat>
        <numImagesOrTiltSeries>12538</numImagesOrTiltSeries>
        <framesPerImage>50</framesPerImage>
        <voxelType>32 BIT FLOAT</voxelType>
        <dimensions>
            <imageWidth>4096</imageWidth>
            <pixelWidth>0.57</pixelWidth>
            <imageHeight>4096</imageHeight>
            <pixelHeight>0.57</pixelHeight>
        </dimensions>
        <details>Sample of catalytic double mutant D541A, D611A of Clostridium butyricum Argonaute in ternary form (mix of monomers and dimers), bound to single stranded guide DNA ([P]-ATTTATGTGATTTTTC), single stranded target DNA (GAAAAATCACATAAAT), and BindCraft-designed de novo dimer disrupting binder Dimbd2 (KSFEEKKEIVIGMLRYMLENFEEYVELYPDNEVLQTLVPEFKKLVEELESETDKEKFLEKLKEISEIYAKLLKEIFGDNGRSLEELKEKIFVHFSGALE). Purified in buffer 20 mM Tris-HCl pH 7.5, 250 mM KCl, 5% glycerol.
50 frame movies, with a 50 e/A^2 electron dose, on a 300 kV Titan Krios with Falcon 4i detector, with 2.7 mm C2 lens, collected with a 0.57 A pixel size.</details>
        <segmentationList/>
        <micrographsFilePattern></micrographsFilePattern>
        <pickedParticlesFilePattern></pickedParticlesFilePattern>
        <pickedParticlesDirectory></pickedParticlesDirectory>
    </imageSet>
</entry>
